PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_15687g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 334aa    MW: 38099.4 Da    PI: 6.7839
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_15687g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.71.7e-152370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT +Ed  l+++v+  G g+W+t+a+  g++Rt+k+c++rw++yl
    MA_15687g0010 23 RGPWTVDEDMNLIRCVTTRGEGRWNTVAKWAGLKRTGKSCRLRWLNYL 70
                     89********************************************97 PP

2Myb_DNA-binding51.81.9e-1676119146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE+ l++++++++G++ W++Iar ++ gRt++++k++w++
    MA_15687g0010  76 RGNITPEEQILILELHRLWGNR-WSKIARQLP-GRTDNEIKNYWRT 119
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.7051870IPR017930Myb domain
SuperFamilySSF466891.61E-2920117IPR009057Homeodomain-like
SMARTSM007174.4E-112272IPR001005SANT/Myb domain
PfamPF002499.5E-142370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-212477IPR009057Homeodomain-like
CDDcd001672.26E-82570No hitNo description
PROSITE profilePS5129425.40371125IPR017930Myb domain
SMARTSM007178.1E-1675123IPR001005SANT/Myb domain
PfamPF002491.1E-1476119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.9E-2478125IPR009057Homeodomain-like
CDDcd001673.01E-1180119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MTKATSCAAA TIRDDQEEQS VRRGPWTVDE DMNLIRCVTT RGEGRWNTVA KWAGLKRTGK  60
SCRLRWLNYL RPDVKRGNIT PEEQILILEL HRLWGNRWSK IARQLPGRTD NEIKNYWRTR  120
IKKHIQKAHC DANPKQLEDS VRYSWLSAIL QQKGIESSNQ SAQAASSSEI IRPSELDYML  180
SQYKWMSSLE TENAGINEPG YSLNPASFRT SQGSLCRRDY LNQNSRTTFQ DGRDMDQPIS  240
EKQNCYNHQS VFDYSNANSV HHEISQAISP SEVGIDNDMS ALVHPIMISE SEELKDLHES  300
AAGFGIQYVN SEAQASSCNN QMSGIEMNWP HELA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25231257108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009384442.13e-67PREDICTED: transcription factor MYB108-like
TrEMBLM0RU136e-68M0RU13_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P20830_0012e-67(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.16e-62myb domain protein 112